- SSFA2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-48718
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- SSFA2
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: EECHHGRTPT CSRLAPPPMS QSTCSLHSIH SEWQERPLCE HTRTLSTHSV PNISGATCSA FASPFGCPYS HRHATYPYRV CSVNP
- ITPR interacting domain containing 2
- CS-1, CS1, KRAP, SPAG13, SSFA2
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Specifications/Features
Available conjugates: Unconjugated